General Information

  • ID:  hor005590
  • Uniprot ID:  Q8UW81
  • Protein name:  Gonadoliberin-2
  • Gene name:  gnrh2
  • Organism:  Verasper moseri (Barfin flounder)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Midbrain tegmentum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Verasper (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPG
  • Length:  10(24-33)
  • Propeptide:  MCASRLVLLLGLLLCVGAHLSSGQHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRNILRNILLDALARELQKRK
  • Signal peptide:  MCASRLVLLLGLLLCVGAHLSSG
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O73811-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005590_AF2.pdbhor005590_ESM.pdb

Physical Information

Mass: 141504 Formula: C60H71N17O14
Absent amino acids: ACDEFIKLMNRTV Common amino acids: GHW
pI: 7.71 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -162 Boman Index: -1186
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 2043 Extinction Coefficient cystines: 12490
Absorbance 280nm: 1387.78

Literature

  • PubMed ID:  12093120
  • Title:  Molecular cloning of three cDNAs encoding different GnRHs in the brain of barfin flounder.